• Skip to content
  • Skip to link menu
  • KDE API Reference
  • kdelibs-4.8.3 API Reference
  • KDE Home
  • Contact Us
 

KDECore

kcalendarsystemislamiccivil.cpp
Go to the documentation of this file.
00001 /*
00002     Copyright (c) 2002-2003 Carlos Moro <cfmoro@correo.uniovi.es>
00003     Copyright (c) 2002-2003 Hans Petter Bieker <bieker@kde.org>
00004     Copyright 2007, 2008, 2009, 2010 John Layt <john@layt.net>
00005 
00006     This library is free software; you can redistribute it and/or
00007     modify it under the terms of the GNU Library General Public
00008     License as published by the Free Software Foundation; either
00009     version 2 of the License, or (at your option) any later version.
00010 
00011     This library is distributed in the hope that it will be useful,
00012     but WITHOUT ANY WARRANTY; without even the implied warranty of
00013     MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU
00014     Library General Public License for more details.
00015 
00016     You should have received a copy of the GNU Library General Public License
00017     along with this library; see the file COPYING.LIB.  If not, write to
00018     the Free Software Foundation, Inc., 51 Franklin Street, Fifth Floor,
00019     Boston, MA 02110-1301, USA.
00020 */
00021 
00022 #include "kcalendarsystemislamiccivil_p.h"
00023 #include "kcalendarsystemprivate_p.h"
00024 
00025 #include <QtCore/QDate>
00026 
00027 class KCalendarSystemIslamicCivilPrivate : public KCalendarSystemPrivate
00028 {
00029 public:
00030     explicit KCalendarSystemIslamicCivilPrivate(KCalendarSystemIslamicCivil *q);
00031 
00032     virtual ~KCalendarSystemIslamicCivilPrivate();
00033 
00034     // Virtual methods each calendar system must re-implement
00035     virtual KLocale::CalendarSystem calendarSystem() const;
00036     virtual void loadDefaultEraList();
00037     virtual int monthsInYear(int year) const;
00038     virtual int daysInMonth(int year, int month) const;
00039     virtual int daysInYear(int year) const;
00040     virtual int daysInWeek() const;
00041     virtual bool isLeapYear(int year) const;
00042     virtual bool hasLeapMonths() const;
00043     virtual bool hasYearZero() const;
00044     virtual int maxDaysInWeek() const;
00045     virtual int maxMonthsInYear() const;
00046     virtual int earliestValidYear() const;
00047     virtual int latestValidYear() const;
00048     virtual QString monthName(int month, int year, KLocale::DateTimeComponentFormat format, bool possessive) const;
00049     virtual QString weekDayName(int weekDay, KLocale::DateTimeComponentFormat format) const;
00050 };
00051 
00052 // Shared d pointer base class definitions
00053 
00054 KCalendarSystemIslamicCivilPrivate::KCalendarSystemIslamicCivilPrivate(KCalendarSystemIslamicCivil *q)
00055                                   : KCalendarSystemPrivate(q)
00056 {
00057 }
00058 
00059 KCalendarSystemIslamicCivilPrivate::~KCalendarSystemIslamicCivilPrivate()
00060 {
00061 }
00062 
00063 KLocale::CalendarSystem KCalendarSystemIslamicCivilPrivate::calendarSystem() const
00064 {
00065     return KLocale::IslamicCivilCalendar;
00066 }
00067 
00068 void KCalendarSystemIslamicCivilPrivate::loadDefaultEraList()
00069 {
00070     QString name, shortName, format;
00071     // Islamic Era, Anno Hegirae, "Year of the Hijra".
00072     name = i18nc("Calendar Era: Hijri Islamic Era, years > 0, LongFormat", "Anno Hegirae");
00073     shortName = i18nc("Calendar Era: Hijri Islamic Era, years > 0, ShortFormat", "AH");
00074     format = i18nc("(kdedt-format) Hijri, AH, full era year format used for %EY, e.g. 2000 AH", "%Ey %EC");
00075     addEra('+', 1, q->epoch(), 1, q->latestValidDate(), name, shortName, format);
00076 }
00077 
00078 int KCalendarSystemIslamicCivilPrivate::monthsInYear(int year) const
00079 {
00080     Q_UNUSED(year)
00081     return 12;
00082 }
00083 
00084 int KCalendarSystemIslamicCivilPrivate::daysInMonth(int year, int month) const
00085 {
00086     if (month == 12 && isLeapYear(year)) {
00087         return 30;
00088     }
00089 
00090     if (month % 2 == 0) {   // Even number months have 29 days
00091         return 29;
00092     } else {  // Odd number months have 30 days
00093         return 30;
00094     }
00095 }
00096 
00097 int KCalendarSystemIslamicCivilPrivate::daysInYear(int year) const
00098 {
00099     if (isLeapYear(year)) {
00100         return 355;
00101     } else {
00102         return 354;
00103     }
00104 }
00105 
00106 int KCalendarSystemIslamicCivilPrivate::daysInWeek() const
00107 {
00108     return 7;
00109 }
00110 
00111 bool KCalendarSystemIslamicCivilPrivate::isLeapYear(int year) const
00112 {
00113     // Years 2, 5, 7, 10, 13, 16, 18, 21, 24, 26, 29 of the 30 year cycle
00114 
00115     /*
00116     The following C++ code is translated from the Lisp code
00117     in ``Calendrical Calculations'' by Nachum Dershowitz and
00118     Edward M. Reingold, Software---Practice & Experience,
00119     vol. 20, no. 9 (September, 1990), pp. 899--928.
00120 
00121     This code is in the public domain, but any use of it
00122     should publically acknowledge its source.
00123     */
00124 
00125     if ((((11 * year) + 14) % 30) < 11) {
00126         return true;
00127     } else {
00128         return false;
00129     }
00130 
00131     // The following variations will be implemented in separate classes in 4.5
00132     // May be cleaner to formally define using a case statement switch on (year % 30)
00133 
00134     // Variation used by Bar Habraeus / Graves / Birashk / Some Microsoft products
00135     // Years 2, 5, 7, 10, 13, 15, 18, 21, 24, 26, 29 of the 30 year cycle
00136     // if ( ( ( ( 11 * year ) + 15 ) % 30 ) < 11 ) {
00137 
00138     // Variation used by Bohras / Sahifa with epoch 15 July 622 jd = 1948440
00139     // Years 2, 5, 8, 10, 13, 16, 19, 21, 24, 27, 29 of the 30 year cycle
00140     // if ( ( ( ( 11 * year ) + 1 ) % 30 ) < 11 ) {
00141 }
00142 
00143 bool KCalendarSystemIslamicCivilPrivate::hasLeapMonths() const
00144 {
00145     return false;
00146 }
00147 
00148 bool KCalendarSystemIslamicCivilPrivate::hasYearZero() const
00149 {
00150     return false;
00151 }
00152 
00153 int KCalendarSystemIslamicCivilPrivate::maxDaysInWeek() const
00154 {
00155     return 7;
00156 }
00157 
00158 int KCalendarSystemIslamicCivilPrivate::maxMonthsInYear() const
00159 {
00160     return 12;
00161 }
00162 
00163 int KCalendarSystemIslamicCivilPrivate::earliestValidYear() const
00164 {
00165     return 1;
00166 }
00167 
00168 int KCalendarSystemIslamicCivilPrivate::latestValidYear() const
00169 {
00170     return 9999;
00171 }
00172 
00173 QString KCalendarSystemIslamicCivilPrivate::monthName(int month, int year, KLocale::DateTimeComponentFormat format, bool possessive) const
00174 {
00175     Q_UNUSED(year);
00176 
00177     if (format == KLocale::NarrowName) {
00178         switch (month) {
00179         case 1:
00180             return ki18nc("Hijri month 1 - KLocale::NarrowName",  "M").toString(locale());
00181         case 2:
00182             return ki18nc("Hijri month 2 - KLocale::NarrowName",  "S").toString(locale());
00183         case 3:
00184             return ki18nc("Hijri month 3 - KLocale::NarrowName",  "A").toString(locale());
00185         case 4:
00186             return ki18nc("Hijri month 4 - KLocale::NarrowName",  "T").toString(locale());
00187         case 5:
00188             return ki18nc("Hijri month 5 - KLocale::NarrowName",  "A").toString(locale());
00189         case 6:
00190             return ki18nc("Hijri month 6 - KLocale::NarrowName",  "T").toString(locale());
00191         case 7:
00192             return ki18nc("Hijri month 7 - KLocale::NarrowName",  "R").toString(locale());
00193         case 8:
00194             return ki18nc("Hijri month 8 - KLocale::NarrowName",  "S").toString(locale());
00195         case 9:
00196             return ki18nc("Hijri month 9 - KLocale::NarrowName",  "R").toString(locale());
00197         case 10:
00198             return ki18nc("Hijri month 10 - KLocale::NarrowName", "S").toString(locale());
00199         case 11:
00200             return ki18nc("Hijri month 11 - KLocale::NarrowName", "Q").toString(locale());
00201         case 12:
00202             return ki18nc("Hijri month 12 - KLocale::NarrowName", "H").toString(locale());
00203         default:
00204             return QString();
00205         }
00206     }
00207 
00208     if (format == KLocale::ShortName && possessive) {
00209         switch (month) {
00210         case 1:
00211             return ki18nc("Hijri month 1 - KLocale::ShortName Possessive",  "of Muh").toString(locale());
00212         case 2:
00213             return ki18nc("Hijri month 2 - KLocale::ShortName Possessive",  "of Saf").toString(locale());
00214         case 3:
00215             return ki18nc("Hijri month 3 - KLocale::ShortName Possessive",  "of R.A").toString(locale());
00216         case 4:
00217             return ki18nc("Hijri month 4 - KLocale::ShortName Possessive",  "of R.T").toString(locale());
00218         case 5:
00219             return ki18nc("Hijri month 5 - KLocale::ShortName Possessive",  "of J.A").toString(locale());
00220         case 6:
00221             return ki18nc("Hijri month 6 - KLocale::ShortName Possessive",  "of J.T").toString(locale());
00222         case 7:
00223             return ki18nc("Hijri month 7 - KLocale::ShortName Possessive",  "of Raj").toString(locale());
00224         case 8:
00225             return ki18nc("Hijri month 8 - KLocale::ShortName Possessive",  "of Sha").toString(locale());
00226         case 9:
00227             return ki18nc("Hijri month 9 - KLocale::ShortName Possessive",  "of Ram").toString(locale());
00228         case 10:
00229             return ki18nc("Hijri month 10 - KLocale::ShortName Possessive", "of Shw").toString(locale());
00230         case 11:
00231             return ki18nc("Hijri month 11 - KLocale::ShortName Possessive", "of Qid").toString(locale());
00232         case 12:
00233             return ki18nc("Hijri month 12 - KLocale::ShortName Possessive", "of Hij").toString(locale());
00234         default:
00235             return QString();
00236         }
00237     }
00238 
00239     if (format == KLocale::ShortName && !possessive) {
00240         switch (month) {
00241         case 1:
00242             return ki18nc("Hijri month 1 - KLocale::ShortName",  "Muh").toString(locale());
00243         case 2:
00244             return ki18nc("Hijri month 2 - KLocale::ShortName",  "Saf").toString(locale());
00245         case 3:
00246             return ki18nc("Hijri month 3 - KLocale::ShortName",  "R.A").toString(locale());
00247         case 4:
00248             return ki18nc("Hijri month 4 - KLocale::ShortName",  "R.T").toString(locale());
00249         case 5:
00250             return ki18nc("Hijri month 5 - KLocale::ShortName",  "J.A").toString(locale());
00251         case 6:
00252             return ki18nc("Hijri month 6 - KLocale::ShortName",  "J.T").toString(locale());
00253         case 7:
00254             return ki18nc("Hijri month 7 - KLocale::ShortName",  "Raj").toString(locale());
00255         case 8:
00256             return ki18nc("Hijri month 8 - KLocale::ShortName",  "Sha").toString(locale());
00257         case 9:
00258             return ki18nc("Hijri month 9 - KLocale::ShortName",  "Ram").toString(locale());
00259         case 10:
00260             return ki18nc("Hijri month 10 - KLocale::ShortName", "Shw").toString(locale());
00261         case 11:
00262             return ki18nc("Hijri month 11 - KLocale::ShortName", "Qid").toString(locale());
00263         case 12:
00264             return ki18nc("Hijri month 12 - KLocale::ShortName", "Hij").toString(locale());
00265         default:
00266             return QString();
00267         }
00268     }
00269 
00270     if (format == KLocale::LongName && possessive) {
00271         switch (month) {
00272         case 1:
00273             return ki18nc("Hijri month 1 - KLocale::LongName Possessive",  "of Muharram").toString(locale());
00274         case 2:
00275             return ki18nc("Hijri month 2 - KLocale::LongName Possessive",  "of Safar").toString(locale());
00276         case 3:
00277             return ki18nc("Hijri month 3 - KLocale::LongName Possessive",  "of Rabi` al-Awal").toString(locale());
00278         case 4:
00279             return ki18nc("Hijri month 4 - KLocale::LongName Possessive",  "of Rabi` al-Thaani").toString(locale());
00280         case 5:
00281             return ki18nc("Hijri month 5 - KLocale::LongName Possessive",  "of Jumaada al-Awal").toString(locale());
00282         case 6:
00283             return ki18nc("Hijri month 6 - KLocale::LongName Possessive",  "of Jumaada al-Thaani").toString(locale());
00284         case 7:
00285             return ki18nc("Hijri month 7 - KLocale::LongName Possessive",  "of Rajab").toString(locale());
00286         case 8:
00287             return ki18nc("Hijri month 8 - KLocale::LongName Possessive",  "of Sha`ban").toString(locale());
00288         case 9:
00289             return ki18nc("Hijri month 9 - KLocale::LongName Possessive",  "of Ramadan").toString(locale());
00290         case 10:
00291             return ki18nc("Hijri month 10 - KLocale::LongName Possessive", "of Shawwal").toString(locale());
00292         case 11:
00293             return ki18nc("Hijri month 11 - KLocale::LongName Possessive", "of Thu al-Qi`dah").toString(locale());
00294         case 12:
00295             return ki18nc("Hijri month 12 - KLocale::LongName Possessive", "of Thu al-Hijjah").toString(locale());
00296         default:
00297             return QString();
00298         }
00299     }
00300 
00301     // Default to LongName
00302     switch (month) {
00303     case 1:
00304         return ki18nc("Hijri month 1 - KLocale::LongName",  "Muharram").toString(locale());
00305     case 2:
00306         return ki18nc("Hijri month 2 - KLocale::LongName",  "Safar").toString(locale());
00307     case 3:
00308         return ki18nc("Hijri month 3 - KLocale::LongName",  "Rabi` al-Awal").toString(locale());
00309     case 4:
00310         return ki18nc("Hijri month 4 - KLocale::LongName",  "Rabi` al-Thaani").toString(locale());
00311     case 5:
00312         return ki18nc("Hijri month 5 - KLocale::LongName",  "Jumaada al-Awal").toString(locale());
00313     case 6:
00314         return ki18nc("Hijri month 6 - KLocale::LongName",  "Jumaada al-Thaani").toString(locale());
00315     case 7:
00316         return ki18nc("Hijri month 7 - KLocale::LongName",  "Rajab").toString(locale());
00317     case 8:
00318         return ki18nc("Hijri month 8 - KLocale::LongName",  "Sha`ban").toString(locale());
00319     case 9:
00320         return ki18nc("Hijri month 9 - KLocale::LongName",  "Ramadan").toString(locale());
00321     case 10:
00322         return ki18nc("Hijri month 10 - KLocale::LongName", "Shawwal").toString(locale());
00323     case 11:
00324         return ki18nc("Hijri month 11 - KLocale::LongName", "Thu al-Qi`dah").toString(locale());
00325     case 12:
00326         return ki18nc("Hijri month 12 - KLocale::LongName", "Thu al-Hijjah").toString(locale());
00327     default:
00328         return QString();
00329     }
00330 }
00331 
00332 QString KCalendarSystemIslamicCivilPrivate::weekDayName(int weekDay, KLocale::DateTimeComponentFormat format) const
00333 {
00334     if (format == KLocale::NarrowName) {
00335         switch (weekDay) {
00336         case 1:
00337             return ki18nc("Hijri weekday 1 - KLocale::NarrowName ", "I").toString(locale());
00338         case 2:
00339             return ki18nc("Hijri weekday 2 - KLocale::NarrowName ", "T").toString(locale());
00340         case 3:
00341             return ki18nc("Hijri weekday 3 - KLocale::NarrowName ", "A").toString(locale());
00342         case 4:
00343             return ki18nc("Hijri weekday 4 - KLocale::NarrowName ", "K").toString(locale());
00344         case 5:
00345             return ki18nc("Hijri weekday 5 - KLocale::NarrowName ", "J").toString(locale());
00346         case 6:
00347             return ki18nc("Hijri weekday 6 - KLocale::NarrowName ", "S").toString(locale());
00348         case 7:
00349             return ki18nc("Hijri weekday 7 - KLocale::NarrowName ", "A").toString(locale());
00350         default:
00351             return QString();
00352         }
00353     }
00354 
00355     if (format == KLocale::ShortName  || format == KLocale:: ShortNumber) {
00356         switch (weekDay) {
00357         case 1:
00358             return ki18nc("Hijri weekday 1 - KLocale::ShortName", "Ith").toString(locale());
00359         case 2:
00360             return ki18nc("Hijri weekday 2 - KLocale::ShortName", "Thl").toString(locale());
00361         case 3:
00362             return ki18nc("Hijri weekday 3 - KLocale::ShortName", "Arb").toString(locale());
00363         case 4:
00364             return ki18nc("Hijri weekday 4 - KLocale::ShortName", "Kha").toString(locale());
00365         case 5:
00366             return ki18nc("Hijri weekday 5 - KLocale::ShortName", "Jum").toString(locale());
00367         case 6:
00368             return ki18nc("Hijri weekday 6 - KLocale::ShortName", "Sab").toString(locale());
00369         case 7:
00370             return ki18nc("Hijri weekday 7 - KLocale::ShortName", "Ahd").toString(locale());
00371         default: return QString();
00372         }
00373     }
00374 
00375     switch (weekDay) {
00376     case 1:
00377         return ki18nc("Hijri weekday 1 - KLocale::LongName", "Yaum al-Ithnain").toString(locale());
00378     case 2:
00379         return ki18nc("Hijri weekday 2 - KLocale::LongName", "Yau al-Thulatha").toString(locale());
00380     case 3:
00381         return ki18nc("Hijri weekday 3 - KLocale::LongName", "Yaum al-Arbi'a").toString(locale());
00382     case 4:
00383         return ki18nc("Hijri weekday 4 - KLocale::LongName", "Yaum al-Khamees").toString(locale());
00384     case 5:
00385         return ki18nc("Hijri weekday 5 - KLocale::LongName", "Yaum al-Jumma").toString(locale());
00386     case 6:
00387         return ki18nc("Hijri weekday 6 - KLocale::LongName", "Yaum al-Sabt").toString(locale());
00388     case 7:
00389         return ki18nc("Hijri weekday 7 - KLocale::LongName", "Yaum al-Ahad").toString(locale());
00390     default:
00391         return QString();
00392     }
00393 }
00394 
00395 
00396 KCalendarSystemIslamicCivil::KCalendarSystemIslamicCivil(const KLocale *locale)
00397                            : KCalendarSystem(*new KCalendarSystemIslamicCivilPrivate(this), KSharedConfig::Ptr(), locale)
00398 {
00399     d_ptr->loadConfig(calendarType());
00400 }
00401 
00402 KCalendarSystemIslamicCivil::KCalendarSystemIslamicCivil(const KSharedConfig::Ptr config, const KLocale *locale)
00403                            : KCalendarSystem(*new KCalendarSystemIslamicCivilPrivate(this), config, locale)
00404 {
00405     d_ptr->loadConfig(calendarType());
00406 }
00407 
00408 KCalendarSystemIslamicCivil::KCalendarSystemIslamicCivil(KCalendarSystemIslamicCivilPrivate &dd,
00409                                                          const KSharedConfig::Ptr config, const KLocale *locale)
00410                            : KCalendarSystem(dd, config, locale)
00411 {
00412     d_ptr->loadConfig(calendarType());
00413 }
00414 
00415 KCalendarSystemIslamicCivil::~KCalendarSystemIslamicCivil()
00416 {
00417 }
00418 
00419 QString KCalendarSystemIslamicCivil::calendarType() const
00420 {
00421     return QLatin1String("hijri");
00422 }
00423 
00424 QDate KCalendarSystemIslamicCivil::epoch() const
00425 {
00426     // 16 July 622 in the Julian calendar
00427     return QDate::fromJulianDay(1948440);
00428 }
00429 
00430 QDate KCalendarSystemIslamicCivil::earliestValidDate() const
00431 {
00432     return epoch();
00433 }
00434 
00435 QDate KCalendarSystemIslamicCivil::latestValidDate() const
00436 {
00437     // Set to last day of year 9999
00438     // Last day of Islamic Civil year 9999 is 9999-12-29
00439     return QDate::fromJulianDay(5491751);
00440 }
00441 
00442 bool KCalendarSystemIslamicCivil::isValid(int year, int month, int day) const
00443 {
00444     return KCalendarSystem::isValid(year, month, day);
00445 }
00446 
00447 bool KCalendarSystemIslamicCivil::isValid(const QDate &date) const
00448 {
00449     return KCalendarSystem::isValid(date);
00450 }
00451 
00452 bool KCalendarSystemIslamicCivil::isLeapYear(int year) const
00453 {
00454     return KCalendarSystem::isLeapYear(year);
00455 }
00456 
00457 bool KCalendarSystemIslamicCivil::isLeapYear(const QDate &date) const
00458 {
00459     return KCalendarSystem::isLeapYear(date);
00460 }
00461 
00462 QString KCalendarSystemIslamicCivil::monthName(int month, int year, MonthNameFormat format) const
00463 {
00464     return KCalendarSystem::monthName(month, year, format);
00465 }
00466 
00467 QString KCalendarSystemIslamicCivil::monthName(const QDate &date, MonthNameFormat format) const
00468 {
00469     return KCalendarSystem::monthName(date, format);
00470 }
00471 
00472 QString KCalendarSystemIslamicCivil::weekDayName(int weekDay, WeekDayNameFormat format) const
00473 {
00474     return KCalendarSystem::weekDayName(weekDay, format);
00475 }
00476 
00477 QString KCalendarSystemIslamicCivil::weekDayName(const QDate &date, WeekDayNameFormat format) const
00478 {
00479     return KCalendarSystem::weekDayName(date, format);
00480 }
00481 
00482 int KCalendarSystemIslamicCivil::weekDayOfPray() const
00483 {
00484     return 5; // Friday
00485 }
00486 
00487 bool KCalendarSystemIslamicCivil::isLunar() const
00488 {
00489     return true;
00490 }
00491 
00492 bool KCalendarSystemIslamicCivil::isLunisolar() const
00493 {
00494     return false;
00495 }
00496 
00497 bool KCalendarSystemIslamicCivil::isSolar() const
00498 {
00499     return false;
00500 }
00501 
00502 bool KCalendarSystemIslamicCivil::isProleptic() const
00503 {
00504     return false;
00505 }
00506 
00507 bool KCalendarSystemIslamicCivil::julianDayToDate(int jd, int &year, int &month, int &day) const
00508 {
00509     Q_D(const KCalendarSystemIslamicCivil);
00510 
00511     /*
00512     The following C++ code is translated from the Lisp code
00513     in ``Calendrical Calculations'' by Nachum Dershowitz and
00514     Edward M. Reingold, Software---Practice & Experience,
00515     vol. 20, no. 9 (September, 1990), pp. 899--928.
00516 
00517     This code is in the public domain, but any use of it
00518     should publically acknowledge its source.
00519     */
00520 
00521     // Search forward year by year from approximate year
00522     year = (jd - epoch().toJulianDay()) / 355;
00523     int testJd;
00524     dateToJulianDay(year, 12, d->daysInMonth(year, 12), testJd);
00525     while (jd > testJd) {
00526         year++;
00527         dateToJulianDay(year, 12, d->daysInMonth(year, 12), testJd);
00528     }
00529 
00530     // Search forward month by month from Muharram
00531     month = 1;
00532     dateToJulianDay(year, month, d->daysInMonth(year, month), testJd);
00533     while (jd > testJd) {
00534         month++;
00535         dateToJulianDay(year, month, d->daysInMonth(year, month), testJd);
00536     }
00537 
00538     dateToJulianDay(year, month, 1, testJd);
00539     day = jd - testJd + 1;
00540 
00541     return true;
00542 
00543     // Alternative implementations
00544 
00545     // More recent editions of "Calendrical Calculations" by Dershowitz & Reingold have a more
00546     // efficient direct calculation without recusrion, but this cannot be used due to licensing
00547 
00548     /*
00549     Formula from "Explanatory Supplement to the Astronomical Almanac" 2006, derived from Fliegel & Van Flandern 1968
00550     int L = jd - epoch().toJulianDay() + 10632;
00551     int N = ( L - 1 ) / 10631;
00552     L = L - 10631 * N + 354;
00553     int J = ( ( 10985 - L ) / 5316 ) x ( ( 50* L ) / 17719 ) + ( L / 5670 ) * ( ( 43 * L ) / 15238 );
00554     L = L - ( ( 30 - J ) / 15 ) * ( ( 17719 * J ) / 50 ) - ( J / 16 ) * ( ( 15238 * J ) / 43 ) + 29;
00555     year = ( 30 * N ) + J - 30;
00556     month = ( 24 * L ) / 709;
00557     day = L - ( ( 709 * month ) / 24 );
00558     */
00559 
00560     /*
00561     Formula from Fourmilab website
00562     jd = Math.floor(jd) + 0.5;
00563     year = Math.floor(((30 * (jd - epoch().toJulianDay())) + 10646) / 10631);
00564     month = qMin(12, Math.ceil((jd - (29 + islamic_to_jd(year, 1, 1))) / 29.5) + 1);
00565     day = (jd - islamic_to_jd(year, month, 1)) + 1;
00566     */
00567 }
00568 
00569 bool KCalendarSystemIslamicCivil::dateToJulianDay(int year, int month, int day, int &jd) const
00570 {
00571     /*
00572     The following C++ code is translated from the Lisp code
00573     in ``Calendrical Calculations'' by Nachum Dershowitz and
00574     Edward M. Reingold, Software---Practice & Experience,
00575     vol. 20, no. 9 (September, 1990), pp. 899--928.
00576 
00577     This code is in the public domain, but any use of it
00578     should publically acknowledge its source.
00579     */
00580 
00581     jd = epoch().toJulianDay() - 1 +   // days before start of calendar
00582          (year - 1) * 354 +            // non-leap days in prior years
00583          (3 + (11 * year)) / 30 +      // leap days in prior years
00584          29 * (month - 1) +            // days so far...
00585          month / 2          +          //            ...this year
00586          day;                          // days so far this month
00587 
00588     return true;
00589 
00590     // Alternative implementations
00591 
00592     /*
00593     Formula from "Explanatory Supplement to the Astronomical Almanac" 2006, derived from Fliegel & Van Flandern 1968
00594     jd = ( 3 + ( 11 * year ) ) / 30 + 354 * year + 30 * month - ( month - 1 ) / 2 + day + epoch().toJulianDay() - 385;
00595     */
00596 }
This file is part of the KDE documentation.
Documentation copyright © 1996-2012 The KDE developers.
Generated on Thu May 10 2012 20:49:29 by doxygen 1.8.0 written by Dimitri van Heesch, © 1997-2006

KDE's Doxygen guidelines are available online.

KDECore

Skip menu "KDECore"
  • Main Page
  • Namespace List
  • Namespace Members
  • Alphabetical List
  • Class List
  • Class Hierarchy
  • Class Members
  • File List
  • File Members
  • Modules
  • Related Pages

kdelibs-4.8.3 API Reference

Skip menu "kdelibs-4.8.3 API Reference"
  • DNSSD
  • Interfaces
  •   KHexEdit
  •   KMediaPlayer
  •   KSpeech
  •   KTextEditor
  • kconf_update
  • KDE3Support
  •   KUnitTest
  • KDECore
  • KDED
  • KDEsu
  • KDEUI
  • KDEWebKit
  • KDocTools
  • KFile
  • KHTML
  • KImgIO
  • KInit
  • kio
  • KIOSlave
  • KJS
  •   KJS-API
  •   WTF
  • kjsembed
  • KNewStuff
  • KParts
  • KPty
  • Kross
  • KUnitConversion
  • KUtils
  • Nepomuk
  • Plasma
  • Solid
  • Sonnet
  • ThreadWeaver
Report problems with this website to our bug tracking system.
Contact the specific authors with questions and comments about the page contents.

KDE® and the K Desktop Environment® logo are registered trademarks of KDE e.V. | Legal